PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009312.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 401aa    MW: 41216 Da    PI: 6.0845
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009312.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.7e-18280314135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Do009312.1 280 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 314
                 99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.571274310IPR000679Zinc finger, GATA-type
SMARTSM004013.6E-18274324IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.5E-15274311IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.24E-15276337No hitNo description
CDDcd002021.77E-14279326No hitNo description
PROSITE patternPS003440280305IPR000679Zinc finger, GATA-type
PfamPF003201.5E-15280314IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MEAAAAAEYG YYGGGGAGHR ERKAAAGCGD HFVVDDLLVL PYDDDEEGDG EAAAGAGDGG  60
APPCLQQTVD GAGAGGGVKE EGGLGNFSAN SSTVTALDSC SNSFSGLADG DFPGEFCEPY  120
DQLAELEWLS NYMGEGEDAF ATEDLQKLKL ISGGFSPAVN VPPAPVAPAA AAASGAQPGM  180
FLPEAPVPAK ARSKRSRAAP GNWSSRLLVL PPPPASPPSP ASMAISPAES GISAQAFPTR  240
KPSKPSKKKD AHPAPQAQPS SATGAQSSGG SAASAEGRRC LHCETDKTPQ WRTGPMGPKT  300
LCNACGVRYK SGRLVPEYRP AASPTFVMSK HSNSHRKVLE LRRQKEVVQH PAPHVIAGGG  360
PAGLMHMQSP LLFDGPAAPP IVAGDDFLIH HHLGADYRQL I
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969927.10.0PREDICTED: GATA transcription factor 12
TrEMBLK3XIL30.0K3XIL3_SETIT; Uncharacterized protein
STRINGSi001735m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.16e-57GATA transcription factor 12